SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012693 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012693
Domain Number 1 Region: 229-387
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000245
Further Details:      
 
Domain Number 2 Region: 69-227
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.69e-50
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000859
Further Details:      
 
Domain Number 3 Region: 25-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000146
Family EGF-type module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012693   Gene: ENSPTRG00000007426   Transcript: ENSPTRT00000013693
Sequence length 387
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:86237280:86251200:-1 gene:ENSPTRG00000007426 transcript:ENSPTRT00000013693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKG
YAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPS
SNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHK
EFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHMACTLRFELLGCELNGCANPLGLKNNS
IPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSPKEVT
GIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFET
PILARYVRILPVAWHNRIALRLELLGC
Download sequence
Identical sequences A0A2I3T1S1
XP_001165898.1.37143 XP_003820464.1.60992 9598.ENSPTRP00000012693 ENSPTRP00000012693 ENSPTRP00000012693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]