SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012761 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012761
Domain Number 1 Region: 411-602,673-845
Classification Level Classification E-value
Superfamily ARM repeat 6.37e-33
Family Armadillo repeat 0.053
Further Details:      
 
Domain Number 2 Region: 21-134
Classification Level Classification E-value
Superfamily TPR-like 3.6e-27
Family Tetratricopeptide repeat (TPR) 0.0027
Further Details:      
 
Domain Number 3 Region: 131-511
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000633
Family Armadillo repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012761   Gene: ENSPTRG00000007465   Transcript: ENSPTRT00000013766
Sequence length 857
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:88309899:88329226:1 gene:ENSPTRG00000007465 transcript:ENSPTRT00000013766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVSGPGTPEPRPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAIL
HRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVS
LEPKNKVFQEALRNIGGQIQEKVRYMSSTDAKVEQMFQILLDPEEKGTEKKQKASQNLVV
LAREDAGAEKIFRSNGVQLLQCLLDTGETDLMLAALRTLVGICSEHQSRTVATLSILGTR
RVVSILGVESQAVSLAACHLLQVMFDALKEGVKKGFRGKEGAIIVDPARELKVLISNLLD
LLTEVGVSGQGRDNALTLLIKAVPRKSLKDPNNSLTLWVIDQGLKKILEVGGSLQDPPGE
LAVTANSRMSASILLSKLFDDLKCDAERENFHRLCENYIKSWFEGQGLAGKLRAIQTVSC
LLQGPCDAGNRALELSGVMESVIALCASEQEEEQLVAVEALIHAAGKAKRASFITANGVS
LLKDLYKCSEKDSIRIRALVGLCKLGSAGGTDFSMKQFAEGSTLKLAKQCRKWLCNDQID
AGTRRWAVEGLAYLTFDADVKEEFVEDAAALKALFQLSRSEERSVLFAVASALVNCTNSY
DYEEPDPKMVELAKYAKQHVPEQHPKDKPSFVRARVKKLLVAGVVSAMVCMVKTESPVLT
SSCRELLSRVFLALVEEVEDRGTVVAQGGGRALIPLALEGTDVGQTKAAQALAKLTITSN
PEMTFPGERIYEVVRPLVSLLHLNCSGLQNFEALMALTNLAGISERLRIPPVTTHWLEIL
QALLLSSNQELQHRGAVVVLNMVEASREIASTLMESEMMEILSVLAKGDHSPVTRAAAAC
LDKAVEYGLIQPNQDGE
Download sequence
Identical sequences ENSPTRP00000012761 ENSPTRP00000012761 9598.ENSPTRP00000012761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]