SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012798 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012798
Domain Number 1 Region: 8-178
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 3.92e-43
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012798   Gene: ENSPTRG00000007492   Transcript: ENSPTRT00000013808
Sequence length 196
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:96480297:96513952:-1 gene:ENSPTRG00000007492 transcript:ENSPTRT00000013808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPRTLVELSKLGLGNETVVQLRTLELPVDYREAKRRVTGIWEDHQPQLVVHVGMDTAAK
AIILEQSGKNQGYRDADIRGFWPEGGVCLPGSPDVLESGVCMKAVCKRVAVEGVDVIFSR
DAGRYVCDYTYYLSLHHGKGCAALIHVPPLSRGLPASLLGRALRVIIQEMLEEVGKPKHK
AQFKENSTMVLPAKGN
Download sequence
Identical sequences A0A2I3RMP4
ENSPTRP00000012798 ENSPTRP00000012798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]