SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012856 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012856
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 7.59e-38
Family Globins 0.00000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012856   Gene: ENSPTRG00000007530   Transcript: ENSPTRT00000013879
Sequence length 142
Comment pep:novel chromosome:CHIMP2.1.4:16:145778:147641:1 gene:ENSPTRG00000007530 transcript:ENSPTRT00000013879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTKTEGTIIVSMWAKISTQADTIGTETLERLFLSHPQTRTYFPRFDLHNGSARLRTHG
YKVMASELNTVKSIDNINGAQSLLRGLRSYILLADRVNFKLLSHCLLVTLAARFPADFTA
EAHAAWDKFLSVVSSVLTEKYR
Download sequence
Identical sequences ENSPTRP00000012856 9598.ENSPTRP00000012856 ENSPTRP00000012856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]