SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012981 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012981
Domain Number 1 Region: 264-459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.48e-34
Family Pentraxin (pentaxin) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012981   Gene: ENSPTRG00000007595   Transcript: ENSPTRT00000014012
Sequence length 473
Comment pep:known_by_projection chromosome:CHIMP2.1.4:16:1510616:1513176:-1 gene:ENSPTRG00000007595 transcript:ENSPTRT00000014012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGNWEVTGPPCGSGCERPPGLPRGVHGQFRSAVCLSGLRWFRRFQEVTWTHLQSIASN
YNVSYNVDVRFRSLAEESQAVAQAVNRSQASVQGELAQLKAWVRKMQRRGRKVDTRLRAL
DLTLGERSQQRARERKAHKAQRDALQDSLACLEGLIHSQGARLAALEGRLPVAHPGTAAL
GPALVPTPTQPEELSPTSLKLQRDRQELRAASEHGGPPQDSSAPLQGRREPPASGSHRVL
SGTAPKDPRQQAWSPQEPGEICGVGPTLVFPNASTKNVVFLSPGFVTALRALSFCSWVRM
ASGRLGTLLSYATEDNDNKLVLHGRDSLLPGSIHFVIGDPAFRELPLQLLLDGQWHHICV
IWTSTQGRYWLHVDRRLVATGSRFREGYEIPPGGSLVLGQEQDSVGGGFDSSEAFVGSMS
GLAIWDRALVPGEVANLAIGKEFPTGAILTLANAALAGGFVQRANCTCLERCP
Download sequence
Identical sequences ENSPTRP00000012981 9598.ENSPTRP00000012981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]