SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013075 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013075
Domain Number 1 Region: 395-533
Classification Level Classification E-value
Superfamily TIMP-like 1.73e-27
Family Netrin-like domain (NTR/C345C module) 0.034
Further Details:      
 
Domain Number 2 Region: 267-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000273
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 3 Region: 211-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family EGF-type module 0.028
Further Details:      
 
Domain Number 4 Region: 330-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013075   Gene: ENSPTRG00000007651   Transcript: ENSPTRT00000014111
Sequence length 536
Comment pep:known_by_projection chromosome:CHIMP2.1.4:16:2537672:2540394:1 gene:ENSPTRG00000007651 transcript:ENSPTRT00000014111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVNAPLGREVLASSTCGRPATRACNASDPRRAHPPALLTSPGGTANPLWPSEKQPRAPLN
VTLTEPLGKAFELVFVSQRFCSDPPASVALLKSQDHGRSWAPLGFFSSHCDLDYGRLPAP
ADGPAGPGPEALCFPAPLAQPDGSGLLAFSMQDSSPPGLDLDSSPVLQDWVTATDVRVVL
TRPSTAGDPRDMEAIVPYSYAATDLQVGGRCKCNGHASRCLLDTQGHLICDCRHGTEGPD
CGRCKPFYCDRPWQRATARESHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHN
TAGRHCHYCREGFYRDPGRALSDRRACRACDCHPVGAAGKTCNQTTGQCPCKDGVTGLTC
NRCAPGFQQSRSPVAPCVKTPIPGPTEDSSPVQPQDCDSHCKPARGSYRISLKKFCKKDY
AVQVAVGAHGEARGAWTRFPVAVLAVFRSGEERARRGSSALWVPAGDAACGCPRLLPGRR
YLLLGGGPGAAAGGAGGRGSGLIPARGSLVLPWRDAWTRRLRRLQRRERRGRCSAA
Download sequence
Identical sequences ENSPTRP00000013075 ENSPTRP00000013075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]