SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013131 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013131
Domain Number 1 Region: 594-775
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-64
Family SPRY domain 0.00000266
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 5.53e-24
Family Pyrin domain, PYD 0.0031
Further Details:      
 
Domain Number 3 Region: 366-431
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.39e-16
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013131   Gene: ENSPTRG00000007690   Transcript: ENSPTRT00000014175
Sequence length 781
Comment pep:known_by_projection chromosome:CHIMP2.1.4:16:3279738:3294346:-1 gene:ENSPTRG00000007690 transcript:ENSPTRT00000014175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTY
YGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSLGENKPRSLKT
PDHPEGNEGNGPRPYGGGAASLRRSQPESGRGLSRKPLSKRRDKASEGLDAQGKPRTRSP
ALPGGRSPGPCRAPEGDQAEVRLRRNASSAGRLQGLAGGAPGRKECRPFEVYLPSGKMRP
RSLEVTISTGEKAPANPEILLTLEETTAANLNSATEPRARPTPDGGASADLKEGPGNPEH
SVTGRPPDTAASPRCHAQEGDPVGGTCVHDSCSFPEAVSGHPQASGSRSPGCPRCQDSHE
RKSPGSLSPQPLPQCKRHLKQVQLLFCEDHDEPICLICSLSQEHQGHRVRPIEEVALEHK
KKIQKQLEHLKKLRKSGEEQRSYGEEKAVSFLKQTEALKQRVQRKLEQVYYFLEQQEHFF
VASLEDVGQMVGQIRKAYDTRVSQDIALLDALIGELEAKECQSEWELLQDIGDILHRAKT
VRVPEQWTTPQEIKQKIQLLHQKSEFVEKSTKYFSETLRSEMEMFNVPELIGAQAHAVNV
ILDAETAYPNLIFSDDLKSVRLGNKWERLPDGPQRFDSCIIVLGSPSFLSGCRYWEVEVG
DKTAWILGACKTSISRKGNMTLSPENGYWVVIMMKENEYQASSVPPTRLLIKEPPKRVGI
FVDYGVGSISFYNVTARSHIYTFASCSFSGPLQPIFSPGTRDGGKNTAPLTICPVGGQGP
D
Download sequence
Identical sequences H2QAF9
ENSPTRP00000013131 ENSPTRP00000013131 XP_016784774.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]