SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013187 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013187
Domain Number 1 Region: 9-49
Classification Level Classification E-value
Superfamily UBA-like 0.00000024
Family TAP-C domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013187   Gene: ENSPTRG00000007722   Transcript: ENSPTRT00000014232
Sequence length 177
Comment pep:known_by_projection chromosome:CHIMP2.1.4:16:4663812:4669847:-1 gene:ENSPTRG00000007722 transcript:ENSPTRT00000014232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYSHHHHQ
MMCTPANTPATPPNFPDALTMFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSA
ASSWPTAASPPGGPQHHQPQPPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER
Download sequence
Identical sequences A0A2I2YYH8 H2QAI0 Q8TB05
gi|21687062|ref|NP_660296.1| 9598.ENSPTRP00000013187 9606.ENSP00000283474 ENSPTRP00000013187 ENSP00000283474 ENSPTRP00000013187 ENSGGOP00000010640 ENSP00000283474 NP_660296.1.87134 NP_660296.1.92137 XP_001169127.1.37143 XP_018867677.1.27298 ENSGGOP00000010640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]