SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013256 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013256
Domain Number 1 Region: 71-172
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 165-210
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000196
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013256   Gene: ENSPTRG00000007765   Transcript: ENSPTRT00000014304
Sequence length 211
Comment pep:known chromosome:CHIMP2.1.4:16:11425834:11426469:-1 gene:ENSPTRG00000007765 transcript:ENSPTRT00000014304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSSAAPARPRPCPAVPAPAPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI
Download sequence
Identical sequences H2QAK6
XP_016784913.1.37143 ENSPTRP00000013256 9598.ENSPTRP00000013256 ENSPTRP00000013256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]