SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013308 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000013308
Domain Number - Region: 81-277,336-451
Classification Level Classification E-value
Superfamily ARM repeat 0.000177
Family GUN4-associated domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013308   Gene: ENSPTRG00000007801   Transcript: ENSPTRT00000014360
Sequence length 651
Comment pep:known chromosome:CHIMP2.1.4:16:15193823:15231141:-1 gene:ENSPTRG00000007801 transcript:ENSPTRT00000014360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPLLHTRLPGDAAASSPAVKTLGASRTGISNMRALENDFFNSPPRKTVRFGGTVTEVL
LKYKKGETNDFELLKNQLLDPDIKDDQIINWLLEFRSSIMYLTKDFEQLISIILRLPWLN
RSQTVVEEYLAFLGNLVSAQTVFLRPCLSMIASHFVPPRVIIKEGDVDVSDSDDEDDNLP
ANFDTCHRALQIIARYVPSTPWFLMPILVEKFPFVRKSERTLECYVHNLLRISVYFPTLR
HEILELIIEKLLKLDVNASRQGIEDAEETATQTCGGTDSTEGLFNMDEDEETEHETKAGP
ERLDQMVHPVAERLDILMSLVLSYMKDVCYVDGKVDNGKTKDLYRDLINIFDKLLLPTHA
SCHVQFFMFYLCSFKLGFAEAFLEHLWKKLQDPSNPAIIRQAAGNYIGSFLARAKFIPLI
TVKSCLDLLVNWLHIYLNNQDSGTKAFCDVALHGPFYSACQAVFYTFVFRHKQLLSGNLK
EGLQYLQSLNFERIVMSQLNPLKICLPSVVNFFAAITNKYQLVFCYTIIERNNRQMLPVI
RSTAGGDSVQTCTNPLDTFFPFDPCVLKRSKKFIDPIYQVWEDMSAEELQEFKKPMKKDI
VEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSVGSPPVLYMQPSPL
Download sequence
Identical sequences H2QAM4
XP_001143837.3.37143 ENSPTRP00000013308 ENSPTRP00000013308 9598.ENSPTRP00000013308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]