SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013735 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013735
Domain Number 1 Region: 281-470
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-38
Family SPRY domain 0.00017
Further Details:      
 
Domain Number 2 Region: 7-81
Classification Level Classification E-value
Superfamily RING/U-box 4.24e-18
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 3 Region: 75-137
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000147
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013735   Gene: ENSPTRG00000008040   Transcript: ENSPTRT00000014834
Sequence length 477
Comment pep:known chromosome:CHIMP2.1.4:16:31383789:31394432:1 gene:ENSPTRG00000008040 transcript:ENSPTRT00000014834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCRACLGRVAGEPAADGTVLCPCCQAPT
RPQALSTNLQLARLVEGLAQVPQGHCEEHLDPLSIYCEQDRALVCGVCASLGSHRGHRLL
PAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQLGKMR
VFLAALEGSLDREAERVRGEAGVALRRELGSLNSYLEQLRQMEKVLEEVADKPQTEFLMK
YCLVTSRLQKILAESPPPARLDIQLPIISDDFKFQVWRKMFRALMPALEELTFDPSSAHP
SLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRWALG
VIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFG
DGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAEA
Download sequence
Identical sequences H2QB00 Q6ZMU5
ENSPTRP00000013735 ENSP00000312675 NP_001008275.2.87134 NP_001008275.2.92137 XP_001157628.2.37143 gi|270265876|ref|NP_001008275.2| 9598.ENSPTRP00000013735 9606.ENSP00000312675 ENSPTRP00000013735 ENSP00000312675 ENSP00000312675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]