SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013916 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013916
Domain Number 1 Region: 319-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-28
Family SPRY domain 0.068
Further Details:      
 
Domain Number 2 Region: 155-323
Classification Level Classification E-value
Superfamily ARM repeat 0.000000211
Family HspBP1 domain 0.076
Further Details:      
 
Domain Number 3 Region: 517-568
Classification Level Classification E-value
Superfamily RING/U-box 0.00000135
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013916   Gene: ENSPTRG00000008149   Transcript: ENSPTRT00000015028
Sequence length 576
Comment pep:known chromosome:CHIMP2.1.4:16:56270336:56320892:1 gene:ENSPTRG00000008149 transcript:ENSPTRT00000015028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVFGWAVFLASRSLGQGLLLTLEEHIAHFLGTGGAATTMGNSCICRDDSGTDDSVDTQQ
QQAENSAVPTADTRSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQE
PPYSMITLHEMAETDEGWLDVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTE
ILNLNGEVACQDSSHPAKHRNTSAVLGCLAEKLAGPASIGLLSPGILEYLLQCLKLQSHP
TVMLFALIALEKFAQTSENKLTISESSISDRLVTLESWANDPDYLKRQVGFCAQWSLDNL
FLKEGRQLTYEKVNLSSIRAMLNSNDVSEYLKISPHGLEARCDASSFESVRCTFCVDAGV
WYYEVTVVTSGVMQIGWATRDSKFLNHEGYGIGDDEYSCAYDGCRQLIWYNARSKPHIHP
CWKEGDTVGFLLDLNEKQMIFFLNGNQLPPEKQVFSSTVSGFFAAASFMSYQQCEFNFGA
KPFKYPPSMKFSTFNDYAFLTAEEKIILPRHRRLALLKQVSIRENCCSLCCDEVADTQLK
PCGHSDLCMDCALQLETCPLCRKEIVSRIRQISHIS
Download sequence
Identical sequences A0A024R6U0 H2QB64 Q96DX4
ENSPTRP00000013916 ENSP00000377942 NP_001292092.1.87134 NP_001292092.1.92137 NP_001292093.1.87134 NP_001292093.1.92137 NP_588609.1.87134 NP_588609.1.92137 XP_003823797.1.60992 XP_003823798.1.60992 XP_005256277.1.92137 XP_008975669.1.60992 XP_008975670.1.60992 XP_009429105.1.37143 XP_009429106.1.37143 XP_009429107.1.37143 XP_016783959.1.37143 ENSP00000377942 ENSP00000443176 9598.ENSPTRP00000013916 9606.ENSP00000377942 ENSPTRP00000013916 gi|45387949|ref|NP_588609.1| ENSP00000377942 ENSP00000443176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]