SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014028 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014028
Domain Number 1 Region: 7-46
Classification Level Classification E-value
Superfamily F-box domain 0.000000000131
Family F-box domain 0.0047
Further Details:      
 
Domain Number 2 Region: 128-204,317-355
Classification Level Classification E-value
Superfamily RNI-like 0.0000000491
Family Rna1p (RanGAP1), N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014028   Gene: ENSPTRG00000008216   Transcript: ENSPTRT00000015146
Sequence length 374
Comment pep:known chromosome:CHIMP2.1.4:16:66432494:66436193:1 gene:ENSPTRG00000008216 transcript:ENSPTRT00000015146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGML
PPYLSACLDHVHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFYAG
RDVLEAVHAVCGAASQLRHLDLRRLPFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGP
GSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNE
AWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYA
ATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLK
LTREPHPWRPTLVA
Download sequence
Identical sequences H2QBA9
ENSPTRP00000014028 XP_009429268.1.37143 XP_511023.2.37143 ENSPTRP00000014028 9598.ENSPTRP00000014028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]