SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014047 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014047
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily L domain-like 7.82e-22
Family U2A'-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014047   Gene: ENSPTRG00000008227   Transcript: ENSPTRT00000015170
Sequence length 754
Comment pep:known_by_projection chromosome:CHIMP2.1.4:16:66600397:66659646:1 gene:ENSPTRG00000008227 transcript:ENSPTRT00000015170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQWELDEEGIRRLGALTLEQPELVESLSLQGSYAGKIHSIGDAFRNFKNLRSLDLSRN
LITSLKGIQYLCSLQDLNLYYNNIPSLVEVSRLQPLPFLKELDLRLNPVVRKDTDYRLFA
VYTLQTLEKLDDRTVREGERKAAKLHFSQLGNSENFLLEVEKSSREKTMKNCVTGESSAS
KVSANVDSRIEMDSNKGLFIPFPNREIKDSLSTSATQGNGTPDQKLDTFPLGTQTQEVAR
REMPSDNHQEDEFRHYSPRQSTVRSPEKMTREGYQVSFLDNKSSGSSPEKELIPKPDTFH
LTHDASLSKCLDVGDSSQIHPYQLPSDVGLENYDSCYSQTLSLHGSLGKRPQRSKNYQEY
SIKPSNDIKTTASHSCGDLLTSLSNPDSSTGRLLKLSSDLYATTHFNSDPAVLVNVEQQL
STSLGDLTPAHGSVPNNAVLGNRTTPLRTLLLSPGTSEHRKIFTKRSLSPSKRGFKWKDN
ILANLNLKHGFRDATGSEPLSSDLGSLHGLPGNHSPPISARTPHVATVLRQLLELVDKHW
NGSGSLLLNKKFLGPARDLLLSLVVPAPSQPRCCSHPEDTMKAFCRRELELKEAAQLVPN
DMESLKQKLVRVLEENLILSEKIQQLEEGAAISIVSGQQSHIYDDLLHKNQQLTMQVACL
NQELAQLKKLEETVAILHESQRSLVVTNEYLLQQLNKEPKGYSGKALLPPEKGHHLGRSS
PFGKSTLSSSSPVAHDTGQYLIQSILDAAPEPGL
Download sequence
Identical sequences H2QBB3
ENSPTRP00000014047 XP_523392.2.37143 ENSPTRP00000014047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]