SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014200 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014200
Domain Number 1 Region: 3-337,394-474,521-725
Classification Level Classification E-value
Superfamily ARM repeat 6.58e-60
Family Armadillo repeat 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014200   Gene: ENSPTRG00000008313   Transcript: ENSPTRT00000015334
Sequence length 782
Comment pep:known chromosome:CHIMP2.1.4:16:70027370:70141798:-1 gene:ENSPTRG00000008313 transcript:ENSPTRT00000015334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPEKDFAPLTPNIVRALNDKLYEKRKVAALEIEKLVREFVAQNNTVQIKHVIQTLSQEF
ALSQHPHSRKGGLIGLAACSIALGKDSGLYLKELIEPVLTCFNDADSRLRYYACEALYNI
VKVARGAVLPHFNVLFDGLSKLAADPDPNVKSGSELLDRLLKDIVTESNKFDLVSFIPLL
RERIYSNNQYARQFIISWILVLESVPDINLLDYLPEILDGLFQILGDNGKEIRKMCEVVL
GEFLKEIKKNPSSVKFAEMANILVIHCQTTDDLIQLTAMCWMREFIQLAGRVMLPYSSGI
LTAVLPCLAYDDRKKSIKEVANVCNQSLMKLVTPEDDEPDELRPGQRQAEPTPDDALPKQ
EGTASGGPDGSCDSSFSSGISVFTAASTERAPVTLHLDGIVQVLNCHLSDTAIGMMTRIA
VLKWLYHLYIKTPRKMFRHTDSLFPILLQTLSDESDEVILKDLEVLAEIASSPAGQTDDP
GPLDGPDLQASHSELQVPTPGRAGLLNTSGTKGLECSPSTPTMNSYFYKFMINLLKRFSS
ERKLLEVRGPFIIRQLCLLLNAENIFHSMADILLREEDLKFASTMVHALNTILLTSTELF
QLRNQLKDLKTLESQNLFCCLYRSWCHNPVTTVSLCFLTQNYRHAYDLIQKFGDLEVTVD
FLAEVDKLVQLIECPIFTYLRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRLQCV
PNPELLQTEDSLKAAPKSQRADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRV
VL
Download sequence
Identical sequences H2QBG8
9598.ENSPTRP00000014200 ENSPTRP00000014200 ENSPTRP00000014200 XP_001170940.1.37143 XP_003829526.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]