SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014661 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014661
Domain Number 1 Region: 202-381
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-35
Family APC10-like 0.0021
Further Details:      
 
Domain Number 2 Region: 1819-1879
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000565
Family ZZ domain 0.0082
Further Details:      
 
Domain Number 3 Region: 1777-1828
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000695
Family ZZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 93-159
Classification Level Classification E-value
Superfamily EF-hand 0.00000187
Family Polcalcin 0.061
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000014661
Domain Number - Region: 1102-1191
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00327
Family Spermadhesin, CUB domain 0.0089
Further Details:      
 
Domain Number - Region: 2706-2795
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0196
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014661   Gene: ENSPTRG00000008583   Transcript: ENSPTRT00000015845
Sequence length 2961
Comment pep:known chromosome:CHIMP2.1.4:17:4020349:4156474:-1 gene:ENSPTRG00000008583 transcript:ENSPTRT00000015845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAPSHSSEDEAAAAGGEGWGPHQDWAAVSGTTPGPGVAAPALPPAAALLEPARLREAA
AALLPTPPCESLVSRHRGALFRWLEERLGRGEESVTLEQFRELLEARGAGCSSEQFEEAF
AQFDAEGDGTVDAENMLEALKNSSGANLQGELSHIIRQLQACSLVPGFIDIFSESKEGLD
IHSSMILRFLHRNRLSSAVMPYPMLEHCNNMCTMRSSVLKESLDQLVQKEKESPGDLTRS
PEMDKLKSVAKCYAYIETSSNSADIDKMTNGETSSYWQSDGSACSHWIRLKMKPDVVLRH
LSIAVAATDQSYMPQQVTVAVGRNASDLQEVRDVHIPSNVTGYVTLLENANVSQLYVQIN
IKRCLSDGCDTRIHGLRAVGFQRVKKSGVSVSDASAIWYWSLLTSLVTASMETNPAFVQT
VLHNTQKALRHMPPLSLSPGSTDFSTFLSPNVLEEVDSFLIRITSCCSTPEVELTLLAFA
LARGSVAKVMSSLCTISDHLDTQYDASSLILSMASVRQNLLLKYGKPLQLTLQACDVKGK
EDKSGPENLLVEPWTRDGFLTETGKTRASTIFSTGTESAFQVTQIRIMVRRGGIGAQCGL
VFAYNSSSDKFCAEEHFKRFEKYDKWKLQELRQFVKSRIGCSSDDLGEDDPIGWFELEEE
WDEADVKLQQCRVAKYLMVKFLCTRQESAERLGVQGLTISGYLRPARAEAEQSVTCAHCR
KDTEESVCGATLLLRTLQFIQQLAHDLVQQKESGLKYKSFLDFAGLDLQIFWNFYSKLKQ
NPREECVSAQTLLLQLLQSCFSVLQGDVLAASEEEKAPIQSPKGVEAAKELYTHLCDVVD
KVDGDSVPMEILKQEVRNTLLNGAAIFFPNRQTRRNHLFTMMNVTEQEHKQSLQLTFRSL
CTYFSDKDPGGLLLLPEKNDLAKMNISEVLAVMDTLVSVAARECELLMLSGAPGEVGSVL
FSLFWSVQGSLLSWCYLQLKSTDSGAKDLAVDLIEKYVGQFLASMRAILESLFSQYSGKT
IVERLCNSVFSMAARQLVIFLLDFCTLDIPHCVLLREFSVLTELLKKLCSGPEGGLRKLD
VETWQQEQPVVLHTWTKESAHNYENNCHEVSVFVSPGATYFEVEFDDRCETEKRYDYLEF
TDARGRKTRYDTKVGTDKWPKKVTFKAGPRLQFLFHSDSSHNEWGYKFTVTACGLPDVAV
SWGLDLQLLVSRLMGRLASQCMALKSVRQLGSNMVVPQAKMALVLSSPLWKPVFRHQVCP
ELELEASWPTHPHRNSKEVKNIPDDPCRHFLLDFAQSEPAQNFCGPYSELFKGFIQACRK
QAPKTDIVAGSTIDQAVNATFAALVYRTPDLYEKLQKYVNSGGKIALSEEFAQVYSLADG
IRIWMLEMKQKSLMSLGNEAEEKHSSEATEVNPESLAKECIEKSLLLLKFLPTGISSKES
CEKLETADETSHLQPLNKRQRTSSVVEEHFQASVSPTEAAPPATGDRSPGLDTQPKLPSS
SGLPAADVSPATAEEPLSPSTPTRRPPFTRGRLRLLSFRSMEEARLVPTVKEKYPVLKDV
MDFIKDQSLSHRSVVKVLSLRKAQAQSILEVLKITQYCAESLGQPHCFHPPFILFLLELL
TCQKDFTNYFGHLEGCGADLHKEIRDTYYQLVLFLVKAVKGFSSLNDRSLLPALSCVQTA
LLHLLDMGWEPSDLAFFVDIQLPDLLMKMSQENISVHDSVISQWSEEDELADAKQNSEWM
DECQDGMFEAWYEKIAQEDPEKQRKMHMFIARYCDLLNVDISCDGCDEIAPWHRYRCLQC
SDMDLCKTCFLGGVKPEGHGDDHEMVNMEFTCDHCQGLIIGRRMNCNVCDDFDLCYGCYA
AKKYSYGHLPTHSITAHPMVTIRISDRQRLIQPYIHNYSWLLFAALALYSAHLASAEDVD
GEKLDPQTRSSATTLRSQCMQLVGDCLMKAHQGKGLKALALLGVLPDGDSSPEDQALPVT
VPTGASEEQLEKKAVQGAELSEAGNGKRAVHEEVRPVDFKQRNKADKGVSLSKDPSCQTQ
ISDSPADASPPTGLPDAEDSEVSSQKPIEEKAVTPSPEQVFAECSQKRILGLLAAMLPPL
KSGPTVPLIDLEHVLPLMFQVVISNAGHLNETYHLTLGLLGQLIIRLLPAEVDAAVIKVL
SAKHNLFAAGDSSIVPDGWKTTHLLFSLGAVCLDSRVGLDWACSMAEILRSLNSAPLWRD
VIATFTDHCIKQLPFQLKHTNIFTLLVLVGFPQVLCVGTRCVYMDNANEPHNVIILKHFT
EKNRAVIVDVKTRKRKTVKDYQLVQKGGGQECGDSRAQLSQYSRHFAFIASHLLQSSMDS
HCPEAVEATWVLSLALKGLYKTLKAHGFEETHATFLQTDLLKLLVKKCSKGTGFSKTWLL
RDLEILSIMLYSSKKEINALAEHGDLELDERGDREEEVERPVSSPGDPEQKKLDPLEGLD
EPTRICFLMAHDALNAPLHILRAIYELQMKKTDYFFLEVQKRFDGDELTTDERIRSLAQR
WQPSKSLRLEEQSAKAVDTDMIILPCLSRPARCDQATAESNPVTQKLISSTESELQQSYA
KQRRSKSAALLHKELNCKSKRAVRDYLFRVNEATAVLYARHVLASLLAEWPSHVPVSEDI
LELSGPAHMTYILDMFMQLEEKHEWEKILQKVLQGCREDMLGSMALAACQFMEEPGMEVQ
VRESKHPYNNNTNFEDKVHIPGAIYLSIKFDSQCNTEEGCDELAMSSSSDFQQDRHSFSG
SQQKWKDFELPGDTLYYRFTSDMSNTEWGYRFTVTAGHLGRFQTGFEILKQMLSEERVVP
HLPLAKIWEWLVGVACRQTGHQRLKAIHLLLRIVRCCGHSDLCDLALLKPLWQLFTHMEY
GLFEDVTQPGILLPLHRALTELFFVTENRAQELGVLQDYLLALTTDDHLLRCAAQALQNI
AAISLAINYPNKATRLWNVEC
Download sequence
Identical sequences A0A2J8KQY2
ENSPTRP00000014661 ENSPTRP00000014661 9598.ENSPTRP00000014661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]