SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014673 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014673
Domain Number 1 Region: 31-217,276-637,761-1025
Classification Level Classification E-value
Superfamily ARM repeat 5.76e-16
Family Armadillo repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014673   Gene: ENSPTRG00000008593   Transcript: ENSPTRT00000015858
Sequence length 1267
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:4559053:4575689:-1 gene:ENSPTRG00000008593 transcript:ENSPTRT00000015858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRDPAEPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLAATEKLLEY
LRGRPKGSEMKYALKRLITGLGVGRETARPCYSLALAQLLQSFEDLPLCSILQQIQEKYD
LHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKA
LVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVGSVNLFS
DENVPRLVNVLKIVQSSVKKDRKLPAVVMLRLALKEDKPRLPKQFKFAPEMDDYVGTFLE
GCQDDPERQLAVLVAFSSVTNQGLPVTPTFWRVVRFLSPPALRGYVAWLRAMFLQPDLDS
LVDFSTNNQKKAQDSSLHMPERAVFRLRKWIIFRLVSIVDSLHLEMEEALTEQVARFCLF
HSFFVTKKPTSQIPETKHPFSFPLENQAREAVSSAFFSLLQTLSTQFKQAPGQTQGGQPW
TYHLVQFADLLLNHSHNVTTVTPFTAQQRQWDRMLQTLKELEAHSAEARAAAFQHLLLLV
GIHLLKSPAESCDLLGDIQTCIRKSLGEKPRRSRTKTIDPQEPPWVEVLVEILLALLAQP
SHLMRQVARSVFGHICSHLTPRALQLILDVLNPETSEDENDRVVVTDDSDERRLKGAEDK
SEEGEDNRSSESEEESEGEESEEEERDGDVDQGFREQLMTVLQAGKALGGEDSENEEELG
DEAMMALDQSLASLFAEQKLRIQARRDEKNKLQKEKALRRDFQIRVLDLVEVLVTKQPEN
ALVLELLEPLLSIIRRSLRSSSSKQEQDLLHKTARIFTHHLCRARRYCHDLGERAEALHA
QVERLVQQAGRQPDSPTALYHFNASLYLLRVLKGNTAEGCVHETQEKQKASTDPSPMPTG
PQAASCLDLNLVTRVYSTALSSFLTKRNSPLTVPMFLSLFSRHPVLCQSLFPILVQHITG
PVRPRHQACLLLQKTLSMREVRSCFEDPEWKQLMGQVLAKVTENLRVLGEAQTKAQHQQA
LSSLELLNVLFRTCKHEKLTLDLTVLLGVLQGQQQSLQQGAHSTGSSRLHDLYWQAMKTL
GVQRPKLEKKDAKEVPSATHSPISKKRKKKGFLPETKKRKKRKSEDGTPAEDGTPAATGG
SQPPSMGRKKRNRTKAKVPAQANGTPTTKSPAPGAPTLSPSTPAKYPKLQKKNQKPSQVN
GAPESPTEPAGQKQHEKALPKKGVLGKSPLSALARKKARLSLVIRSPSLLQSGAKKKKVQ
LRKAGKP
Download sequence
Identical sequences ENSPTRP00000014673 ENSPTRP00000014673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]