SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014909 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014909
Domain Number 1 Region: 468-601
Classification Level Classification E-value
Superfamily TIMP-like 2.75e-37
Family Netrin-like domain (NTR/C345C module) 0.01
Further Details:      
 
Domain Number 2 Region: 285-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000028
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 3 Region: 341-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 4 Region: 404-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 95-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000118
Family Galactose-binding domain 0.046
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000014909
Domain Number - Region: 155-226
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0732
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014909   Gene: ENSPTRG00000008752   Transcript: ENSPTRT00000016112
Sequence length 605
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:46865071:47084623:-1 gene:ENSPTRG00000008752 transcript:ENSPTRT00000016112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAF
GKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCW
QSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQ
CRKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQD
WVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDD
SLVCDCRHHTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLS
GRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAGKTCNQTT
GQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASK
GKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSR
DIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKIQQREKKGK
CKKAK
Download sequence
Identical sequences ENSPTRP00000014909 9598.ENSPTRP00000014909 ENSPTRP00000014909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]