SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014998 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014998
Domain Number 1 Region: 333-508
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-43
Family SPRY domain 0.00042
Further Details:      
 
Domain Number 2 Region: 119-176
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000336
Family B-box zinc-binding domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014998   Gene: ENSPTRG00000041886   Transcript: ENSPTRT00000016204
Sequence length 532
Comment pep:known_by_projection scaffold:CHIMP2.1.4:GL392651.1:52428:74761:-1 gene:ENSPTRG00000041886 transcript:ENSPTRT00000016204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELDLMAPGPLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEKLGRETEEQDS
DSAEQGDPAGEGKEVLCDFCLDDTRRVKAVKSCLTCMVNYCEEHLQPHQVNIKLQSHLLT
EPVKDHNWRYCPAHHSPLSAFCCPDQQCICQDCCQEHSGHTIVSLDAARRDKEVSVSEVK
AVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERM
AAISNTVQFLEEYCKFKNTEDITFPSVYIGLKDKLSGIRKVITESTVHLIQLLENYKKKL
QEFSKEEEYDIRTQVSAVVQRKYWTSKPEPTTREQFLQYAYDITFDPDTAHKYLRLQEEN
RKVTNTTPWEHPYPDLPSRFLHWRQVLSQQSLYLHRYYFEVEIFGAGTYVGLTCKGIDRK
GEERNSCISGNNFSWSLQWNGKEFTAWYSDMETPLKAGPFRRLGVYIDFPGGILSFYGVE
YDTMTLVHKFACKFSEPVYAAFWLSKKENAIRIVDLGEEPEKPAPSLVGTAP
Download sequence
Identical sequences ENSPTRP00000014998 ENSPTRP00000057084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]