SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015086 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015086
Domain Number 1 Region: 89-396
Classification Level Classification E-value
Superfamily L domain-like 5.36e-57
Family Leucine rich effector protein YopM 0.046
Further Details:      
 
Domain Number 2 Region: 489-629
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.71e-36
Family Gelsolin-like 0.00028
Further Details:      
 
Domain Number 3 Region: 1155-1263
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.63e-25
Family Gelsolin-like 0.00082
Further Details:      
 
Domain Number 4 Region: 609-720
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.58e-24
Family Gelsolin-like 0.00072
Further Details:      
 
Domain Number 5 Region: 899-943,978-1063
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.8e-23
Family Gelsolin-like 0.013
Further Details:      
 
Domain Number 6 Region: 698-848
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.52e-21
Family Gelsolin-like 0.0028
Further Details:      
 
Domain Number 7 Region: 7-119
Classification Level Classification E-value
Superfamily L domain-like 2.95e-18
Family Internalin LRR domain 0.043
Further Details:      
 
Domain Number 8 Region: 1053-1145
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0000000000000374
Family Gelsolin-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015086   Gene: ENSPTRG00000008847   Transcript: ENSPTRT00000016300
Sequence length 1270
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:37661396:37675297:1 gene:ENSPTRG00000008847 transcript:ENSPTRT00000016300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATGVLPFVRGVDLSGNDFKGGYFDENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEH
LSVSHNNLTTLHGELSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSHNQLTECP
RELENAKNMLVLNLSHNSIDTIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLV
LNGNPLLHAQLRQLPAMTALQTLHLRSTQRTQSNLPTSLEGLSNLADVDLSCNDLTRVPE
CLYTLPSLRRLNLSSNQITELSLCIDQWVHVETLNLSRNQLTSLPSAICKLSKLKKLYLN
SNKLDFDGLPSGIGKLTNLEEFMAANNNLELVPESLCRCPKLRKLVLNKNYLVTLPEAIH
FLTEIEVLDVRENPNLVMPPKPADRAAEWYNIDFSLQNQLRLAGASPATVAAAAAAGSGP
KDPMARKMRLRRRKDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGL
EKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGS
LNWEIYYWIGGEATLDKKACSAIHAVNWRNYLGAECRTVREEMGDESEEFLQVFDNDISY
IEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWR
GAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKHVPDD
FWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVGLMPRMRLLQSLLDTRCVYILDC
WSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDD
VLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEW
NEDLDGMEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKKEDKEEEKA
EGKEGEEATAEAEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPGKLEVV
RMTQQQENPKFLSHFKRKFIIHRGKRKAVQGAQQPSLYQIRTNGSALCTRCIQINTDSSL
LNSEFCFILKVPFESEDNQGIVYAWVGRASDPDEAKLAEDILNTMFDTSYSKQVINEGEE
PENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKCSDFCQDDLADDDIMLLD
NGQEVYMWVGTQTSQVEIKLSLKACQVYIQHMRSKEHERPRRLRLVRKGNEQHAFTRCFH
AWSAFCKALA
Download sequence
Identical sequences ENSPTRP00000015086 ENSPTRP00000015086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]