SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015102 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015102
Domain Number 1 Region: 9-154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1e-52
Family Galectin (animal S-lectin) 0.0000948
Further Details:      
 
Domain Number 2 Region: 201-321
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.6e-41
Family Galectin (animal S-lectin) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015102   Gene: ENSPTRG00000008901   Transcript: ENSPTRT00000016316
Sequence length 322
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:29442100:29459837:-1 gene:ENSPTRG00000008901 transcript:ENSPTRT00000016316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAF
HFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFV
QYFHRVPFHRVDTISINGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQK
PPGVWPANPAPITQTVIHTVQSAPGQMFSLSGTVLPSAQRFHINLCSGSHIAFHLNPRFD
ENAVVRNTQINNSWGSEERSLPRKMPFVRGQSFLVWILCEAHCLKVAVDGQHVFEYYHRL
RNLPTINKLEVGGDIQLTHVQT
Download sequence
Identical sequences ENSPTRP00000015102 ENSPTRP00000015102 9598.ENSPTRP00000015102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]