SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015115 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015115
Domain Number 1 Region: 418-628
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.14e-37
Family WD40-repeat 0.00019
Further Details:      
 
Domain Number 2 Region: 275-397
Classification Level Classification E-value
Superfamily F-box domain 0.00000000366
Family F-box domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015115   Gene: ENSPTRG00000008859   Transcript: ENSPTRT00000016330
Sequence length 1002
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:37109093:37145371:-1 gene:ENSPTRG00000008859 transcript:ENSPTRT00000016330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENLESRLKNAPYFCCEKGTDSIPLCRKCETCVLAWKIFSTKEWFCRINDISQRRFLVGI
LKQLNSLYLLHYFQNILQTTQGKDFIYNRSRINLSKKEGKVVKSSLNQMLDKTVERKMKE
ILYWFANSTQWTKANYTLLLLQMCNPKLLLTAANVIRVLFLREENNISGLNQDITDVCFS
PEKDHSSKSATSQVYWTAKTPHTSLPLSKAPENEHLLGAASNPEEPWRNSLRCISEMNRL
FSGKGDITKPGYDPCNLLVDLDDIRDLSSGFSKYRDFIRYLPIHLAKYILRMLDRHTLNK
CASVSQHWAAMAQQVKMDLSAHGFTQNQITFLQGSYTRGIDPNYANKVSIPVPKMVDDGK
SMRVKHPKWKLRTKNEYNLWTAYQNEETQQVLMEERNVFCGTYNVRILSDTWDQNRVIHY
SGGDLIAVSSNRKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYW
DLKSGVCARIFGGHQGTITCMDLCKNRLVSGGRDCQVKTLNGHEGAVKCLFFDQWHLLSG
STDGLVMAWSMVGKYERCLMAFKHPKEVLDVSLLFLRVISACADGKIRIYNFLNGNCMKV
IKANGRGDPVLSFFIQGNRMVVNTESNVLMFQFEHIKWQYAVEKTKQKKNKEKEEEKEEN
SLMEILSKCNIQVHSPRESVSSKQTVIQELLPGKPPKSRVLLKPAKFSSAVLIEELQSQG
KSKSPRRDADDVEKAQKQGQLETPGKLPSHPKKKSWKIPMSPDQFLLTVCALQQAHNSGE
FAYPCRPQTEITDVWGPSISYPRKVLNFKGKSIQRAVDRLRLSNPPIDVKRTSIPLEIQK
LQPNLKISLHSPRVQSTIPQPMIIRSRFSGSLKGGDQVTSSIERAVCSTGPLTSMQVIKP
NRMLAPQVGTATLSLKKERPRIYTALDPFRVNTEFVLLTVKEEKEHQEAKMKEYQAREST
GVVDPGKASKAAWIRKIKGLPIDNFTKQGKTAAPELGQNVFI
Download sequence
Identical sequences ENSPTRP00000015115 ENSPTRP00000015115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]