SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015265 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015265
Domain Number 1 Region: 416-527
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-22
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 597-704
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.09e-20
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 3 Region: 710-775
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 769-831
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000564
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 356-421
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000473
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 836-896
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000223
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 7 Region: 532-596
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000222
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 8 Region: 241-357
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000366
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015265   Gene: ENSPTRG00000008942   Transcript: ENSPTRT00000016493
Sequence length 994
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:28065808:28117493:1 gene:ENSPTRG00000008942 transcript:ENSPTRT00000016493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPVALLLLPSLLALLAHGLSLEAPTVGKGQAPGIEETDGELTAAPTPEQPERGVHFVTT
APTLKLLNHHPLLEEFLQEGLEKGDEELRPALPFQPDPPAPFTPSPLPRLANQDSRPVFT
SPTPAMAAVPTQPQSKEGPWSPESESPMLRITAPLPPGPSMAVPTLGPGEIASTTPPSRA
WTPTQEGPGDMGRPWVAEVVSQGAGIGIQGTITSSTASGDDEETTTTTTIITTTITTVQT
PGPCSWNFSGPEGSLDSPTDLSSPTDVGLDCFFYISVYPGYGVEIKVQNISLREGETVTV
EGLGGPDPLPLANQSFLLRGQVIRSPTHQAALRFQSLPPPAGPGTFHFHYQAYLLSCHFP
RRPAYGDVTVTSLHPGGSARFHCATGYQLKGTRHLTCLNATQPFWDSKEPVCIAACGGVI
RNATTGRIVSPGFPGNYSNNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVE
APPVYDSYEVEYLPIEGLLSSGKHFFVELSTDSSGAAAGMALRYEAFQQGHCYEPFVKYG
NFSSSEPTYPVGTTVEFSCDPGYTLEQGSIIIECVDPHDPQWNETEPACRAVCSGEITDS
AGVVLSPNWPEPYGRGQDCIWGVHVEEDKRIMLDIRVLRIGPGDVLTFYDGDDLTARVLG
QYSGPRSHFKLFTSMADVTIQFQSDPGTSVLGYQQGFVIHFFEVPRNDTCPELPEIPNGW
KSPSQPELVHGTVVTYQCYPGYQVVGSSVLMCQWDLTWSEDLPSCQRVTSCHDPGDVEHS
RRLISSPKFPVGATVQYICDQGFVLTGSSILTCHDRQAGSPKWSDRAPKCLLEQLKPCHG
LSAPENGARSPEKRLHPAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAASL
DGFYNSRSLDVAKAPAASSTLDAAHIAAAIFLPLVAMMLLVGGIYFYFSRLQGKSSLQLP
RPRPRPYNRITIESAFDNPTYETGSLSFAGDERI
Download sequence
Identical sequences H2QCJ9
XP_001139913.1.37143 ENSPTRP00000015265 ENSPTRP00000015265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]