SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015302 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015302
Domain Number 1 Region: 59-119
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000000311
Family ComEA-like 0.042
Further Details:      
 
Domain Number 2 Region: 170-354
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000311
Family Mitochondrial resolvase ydc2 catalytic domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015302   Gene: ENSPTRG00000008965   Transcript: ENSPTRT00000016532
Sequence length 360
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:26169125:26176770:1 gene:ENSPTRG00000008965 transcript:ENSPTRT00000016532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSVLFTAGERWRCFLTPSRSSLFWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENA
LDKLFSSEQQASILHVLNTASTKELEAFRLLRGRRSINIVEHRENFGPFQNLESLMNVPL
FKYKSTVQVCNSILCPKTGREKRKSPENRFLRKLLKPDIERERLKAVNSIISIVFGTRRI
AWAHLDRKLTVLDWQQSDRWSLMRGIYSSSVYLEEISSIISKMPKADFYVLEKTGLSIQN
SSLFPILLHFHIMEAMLYALLNKTFAQDGQHQVLSMNRNAVGKHFELMIGDSRTSGKELV
KQFLSDSILKADPRVFFPSDKIVHYRQMFLSTELQRVEELYDSLLQAIAFYELAVFDSQP
Download sequence
Identical sequences G3RXU1 H2QCL7
ENSPTRP00000015302 ENSPTRP00000015302 XP_003812022.1.60992 XP_004042019.1.27298 XP_511389.2.37143 ENSGGOP00000020628 ENSGGOP00000020628 9598.ENSPTRP00000015302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]