SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015306 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015306
Domain Number 1 Region: 257-424
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-42
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 20-91
Classification Level Classification E-value
Superfamily RING/U-box 2.78e-16
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015306   Gene: ENSPTRG00000008967   Transcript: ENSPTRT00000016536
Sequence length 436
Comment pep:known chromosome:CHIMP2.1.4:17:26078650:26104778:-1 gene:ENSPTRG00000008967 transcript:ENSPTRT00000016536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLGLGPGPGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARGARR
WACPTCRQGAAQQPQLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSPRSSAAARP
RRRPELQRVAVEKSVTEVGQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSS
GVDLSMASPKLVTSDTAAGKIRDILHDLEEIQEKLQENVTRKEAPEAQMQGELLEAPSSS
SCPLPDQSHPALRRASRFAQWAIHPTFNLKSLSCSLEVSKDSRTVTVSHRPQPYRWSCER
FSTSQVLCSQALSSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVEWKGTSQ
LSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWL
YGLHPGNYLIIKQVKV
Download sequence
Identical sequences H2QCL9
9598.ENSPTRP00000015306 XP_001174802.1.37143 ENSPTRP00000015306 ENSPTRP00000015306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]