SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015328 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015328
Domain Number 1 Region: 548-681
Classification Level Classification E-value
Superfamily L domain-like 3.78e-24
Family Ngr ectodomain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015328   Gene: ENSPTRG00000034311   Transcript: ENSPTRT00000016560
Sequence length 697
Comment pep:novel scaffold:CHIMP2.1.4:GL392684.1:11645:26241:1 gene:ENSPTRG00000034311 transcript:ENSPTRT00000016560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLLTWQLLSLLVKEAQPLVWVKDPLQLTSNSLGPPEPWSSRSSHLPWESPHAPAPPAAPG
DFDYLGPSASSQMSALPQEPTENLAPYLMELDSAGELPLGPEPFLAAHQDLNDKRTPEEK
LPEVVPLLDRDQNQALVQLPRLKWVQTTDPDRAAGHQADEILVPLDSKVSRPTKFVVSPK
NLKKDLAERWSLAEIVGIPHQLSKPQRQKQTLPDDYLSMDTLYPGSLPPELRVNADEPPG
PPEQVGLSQFHLEPKSQNPETLEDIQSSSLQEEAPAQLLQLPQEVEPSTQQEAPALPPES
SMESLAQTPLNHEVTVQPPGEDQAHYNSPNITVKPADVEVTMTSEPKNETESTQAQQEAP
IQPPEEVEPSSTALRTTAPPPEHPEVTLPPSDKGQAQHSHLTEATVQPVDLELSITTEPT
TEVKPSPTTEETSAQPPDLGLAITPEPTTETGHSTALEKTRAPHPDQVQTLHRSLTEVTG
PPTKLESSQDSLVQSETAPEEQKASTSTNICELCTCGDETLSCVGLSPKQRLRQVPVPEP
DTYNGIFTTLNFQGNYISYIDGNVWKAYSWTEKLILSENYLTELPKDSFEGLLYLQYLDL
SCNKIRYIERQTFESLPFLQYINLGCNLITQLSLGTFQAWHGMQFLHNLILNRNPLTTVE
DPYLFELPALKYLDMGTTHITLTTLKNILTITVELEK
Download sequence
Identical sequences ENSPTRP00000015328 ENSPTRP00000015328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]