SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015453 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015453
Domain Number 1 Region: 201-322
Classification Level Classification E-value
Superfamily SH2 domain 1.08e-24
Family SH2 domain 0.00052
Further Details:      
 
Domain Number 2 Region: 326-365
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000602
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015453   Gene: ENSPTRG00000009068   Transcript: ENSPTRT00000016703
Sequence length 392
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:19005151:19048833:-1 gene:ENSPTRG00000009068 transcript:ENSPTRT00000016703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKRPSGELAASAASLT
DMGGSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTSPHPPTPP
PPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIAPIRAAESLH
SQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSD
PRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLY
FLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIR
KFYYYDPQEEVYLSLKEAQLISKQKQEVEPST
Download sequence
Identical sequences ENSPTRP00000015453 9598.ENSPTRP00000015453 ENSPTRP00000015453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]