SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015475 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015475
Domain Number 1 Region: 850-898
Classification Level Classification E-value
Superfamily L domain-like 0.0000425
Family Ngr ectodomain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015475   Gene: ENSPTRG00000009256   Transcript: ENSPTRT00000016726
Sequence length 899
Comment pep:novel scaffold:CHIMP2.1.4:GL392694.1:45484:54108:1 gene:ENSPTRG00000009256 transcript:ENSPTRT00000016726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAQCPALACVMSQLRFWGPWPLLMWQLLWLLVKEAQPLEWVRDPLQLTSNPLGPPEPW
SSHSSHFPWESPHAPTLPADPWDFDHLGPSASSEMPAPPQESTENLVPFLDTWDSAGELP
LEPEQFLASQLKKDPGQRWSLAGIIGITRQLSTPQSQKQTLQDEYSSMDTPYPGSLPPEL
WVKSDEPPGPSEQVGPSQFHLEPETQNPETLEDIQSSSLQQEAPAQLPQLPEEEEPSSMQ
QEAPALPPESSMESLTLPNHEVTVQPPGEDRAHYHSPNITVKPADVEVTITSEPTNETES
SQAQQEAAIQFLEEVEPSATQQEAPIEPPVPPVEHELSISEQQQPVQPSESSGEVESSPT
QQETPGQPPEHHEVTVSPPGHHQTRHLDSPSVSVKPPDVQLTIAAEPSAEVGTSLVHQEA
TAQLSGSGNDVEPPAIQHGGPPLLPESSEEAGPLAVQQETSFQSPEPINNENPSPTQQEA
AAEHPQTAEEGESSLTHQEAPAQIPEFPNVVVAQPPEHSHLTQAAVQPLDLEFTITPESM
TEVELSPTMKETPTQPPKKVVLQLRVYQGLTNPTPGQDQAQHPVSPSVTVQLLDLELTIT
PEPTTEVGHSTSPKRTIVSPKHPEVTLPHPDQVQTQHSHLTRATVQPLDLGFTITPKSMT
EVEPSTALMTTAPPPEHPEVTLPPSDKGQAQHSHLTQATVQPLDLELTITTKPTTEIKSS
PTTEETSTQPPDLGLAITPEPTTEIGHSTALEKTTAPHPDQLQTLHRKLTEVTGPPTELE
PTQDSLVQSESYIQDKALTAPEEQKASTSTNICELCTCGDEMLSCIDLNPEQRLRQVPVP
EPNTHNGTFTILNFQGNYISYIDGNVWKAYSWTEKLILRENNLTELHKDSFEGLLSLQY
Download sequence
Identical sequences ENSPTRP00000015475 ENSPTRP00000015475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]