SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015667 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015667
Domain Number 1 Region: 276-533
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.14e-99
Family STAT DNA-binding domain 0.0000603
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 4.05e-39
Family Transcription factor STAT-4 N-domain 0.0004
Further Details:      
 
Domain Number 3 Region: 534-651
Classification Level Classification E-value
Superfamily SH2 domain 1.01e-33
Family SH2 domain 0.00025
Further Details:      
 
Domain Number 4 Region: 136-281
Classification Level Classification E-value
Superfamily STAT 3.53e-27
Family STAT 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015667   Gene: ENSPTRG00000009198   Transcript: ENSPTRT00000016925
Sequence length 749
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:15161601:15192462:1 gene:ENSPTRG00000009198 transcript:ENSPTRT00000016925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVCEKLAEIIWQNRQ
QIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAAT
VRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGT
LSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVH
GSQDNNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLV
FLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWND
GAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDF
SIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPSKAVDGYVKPQIKQVVPEFVNASA
DAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRP
MDSRGSRTHNRDPATSPSFFILTRGSLLW
Download sequence
Identical sequences ENSPTRP00000015667 ENSPTRP00000015667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]