SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015670 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015670
Domain Number 1 Region: 322-575
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.33e-109
Family STAT DNA-binding domain 0.000000000166
Further Details:      
 
Domain Number 2 Region: 136-321
Classification Level Classification E-value
Superfamily STAT 5.1e-64
Family STAT 0.00000000791
Further Details:      
 
Domain Number 3 Region: 576-714
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-43
Family SH2 domain 0.0000000921
Further Details:      
 
Domain Number 4 Region: 1-120
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 5.36e-42
Family Transcription factor STAT-4 N-domain 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015670   Gene: ENSPTRG00000009200   Transcript: ENSPTRT00000016928
Sequence length 770
Comment pep:known chromosome:CHIMP2.1.4:17:15002836:15077347:1 gene:ENSPTRG00000009200 transcript:ENSPTRT00000016928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Download sequence
Identical sequences A0A0D9S1T9 A0A2I2Z8R2 A0A2I3MP47 A0A2I3SFL1 A0A2J8RF43 A0A2K5QPU4 A0A2K5TRQ7 A0A2K6PPE4 G1RLB0 H9FYX9 M3VY01 P40763 U3BQV2
gi|21618340|ref|NP_644805.1| ENSP00000264657 ENSP00000467985 HR5535 ENSFCAP00000001991 ENSPANP00000020703 ENSP00000264657 9598.ENSPTRP00000015670 9606.ENSP00000264657 ENSNLEP00000024350 ENSP00000264657 ENSP00000467985 ENSNLEP00000014018 NP_001296441.1.31192 NP_644805.1.87134 NP_644805.1.92137 XP_001165480.2.37143 XP_003279510.1.23891 XP_003813924.1.60992 XP_003996930.1.62641 XP_004282863.1.21590 XP_004434510.1.5094 XP_004655420.1.11716 XP_004655421.1.11716 XP_005257674.2.92137 XP_005584298.1.63531 XP_006092428.1.53796 XP_006175252.1.101512 XP_006199297.1.17985 XP_006199298.1.17985 XP_007087724.1.5354 XP_007102208.1.24612 XP_007177857.1.59432 XP_008010836.1.81039 XP_008010837.1.81039 XP_008147581.1.99482 XP_008517426.1.77740 XP_008699510.1.72690 XP_008833515.1.79516 XP_010384512.1.97406 XP_011226922.1.58354 XP_011523447.1.92137 XP_012299335.1.9421 XP_012299336.1.9421 XP_014402723.1.60319 XP_014689081.1.49734 XP_014975187.1.72884 XP_015351167.1.40921 XP_016057675.1.3490 XP_017364901.1.71028 XP_017499223.1.32401 XP_017499225.1.32401 XP_018883237.1.27298 XP_019290901.1.44245 XP_019290902.1.44245 XP_019522606.1.44202 XP_019603269.1.88060 XP_019603270.1.88060 XP_019673464.1.62641 XP_019794979.1.83887 ENSPTRP00000015670 ENSPTRP00000015670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]