SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015730 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015730
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.07e-24
Family PB1 domain 0.00000432
Further Details:      
 
Domain Number 2 Region: 208-263
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000612
Family ZZ domain 0.0091
Further Details:      
 
Domain Number 3 Region: 916-953
Classification Level Classification E-value
Superfamily UBA-like 0.00000000185
Family UBA domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015730   Gene: ENSPTRG00000009241   Transcript: ENSPTRT00000016991
Sequence length 964
Comment pep:known chromosome:CHIMP2.1.4:17:14173429:14214194:-1 gene:ENSPTRG00000009241 transcript:ENSPTRT00000016991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINS
QGEYEEALKMAVKQGNQLQMQVHEGQHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRV
LGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEK
LVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNIC
EDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRIPAALEQVRLQKQVDKNFLKA
EKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLP
LQPCTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLT
LASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDP
FPSEESPDNIEKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTEQTEGTAACIPQKAKN
VASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDMTPCMSPLPHDSPLIE
KPGLGQIEEENEGAGFKALPDSMVSVKRKAENIASVEEAEEDLSGTQFVCETVIRSLTLD
AAPDHNPPCRQKSLQMTFALPEGPLGNEREEIIHIAEEEAVMEEEEDEEEEEDELKDEVQ
SQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGEPGVEAGQEPAEAGER
LPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSSPCVHHHGSPGVDLPVTI
PEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKALFA
GPPVTAQPIVSEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNNDWY
SQRY
Download sequence
Identical sequences H2QD47
ENSPTRP00000015730 ENSPTRP00000015730 XP_001155730.1.37143 XP_001155786.1.37143 XP_003315527.1.37143 XP_009430395.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]