SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015874 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015874
Domain Number 1 Region: 37-150
Classification Level Classification E-value
Superfamily L domain-like 3.91e-22
Family Internalin LRR domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015874   Gene: ENSPTRG00000009338   Transcript: ENSPTRT00000017147
Sequence length 288
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:9769020:9774948:-1 gene:ENSPTRG00000009338 transcript:ENSPTRT00000017147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGKSAQGPEEGGVCITEALITKRNLTFPEDGELSEKMFHTLDELQTVRLDREGITTIR
NLEGLQNLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSEN
LIETLKLDEFPQSLLILNLSGNSCTNQDGYDEEFPELSGPFCSDRGFLKELEQELSRHRE
HRQQTALTEHLLRMEMQPTLTDLPLLPGVPMAGDSSPSATPAQGEETVPEAVSSPQASSP
TKKPCSLIPRGHQSSLWGRKGAQAATAPKASVAEAPRTTKTTAKRSKK
Download sequence
Identical sequences ENSPTRP00000015874 ENSPTRP00000015874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]