SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015962 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015962
Domain Number 1 Region: 19-124
Classification Level Classification E-value
Superfamily L domain-like 9.98e-27
Family Ngr ectodomain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015962   Gene: ENSPTRG00000009398   Transcript: ENSPTRT00000017241
Sequence length 307
Comment pep:known chromosome:CHIMP2.1.4:17:48972427:48988791:-1 gene:ENSPTRG00000009398 transcript:ENSPTRT00000017241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKLTTLPSDFCG
LTHLVKLDLSKNKLQQLPADFGRLVNLQHLDLLNNKLVTLPVSFAQLKNLKWLDLKDNPL
DPVLAKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQRAK
EAQERELRKREKAEEKERRRKEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRK
HTRSWAVLKLLLLLLLFGVAGGLVACRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWV
LQTDSQQ
Download sequence
Identical sequences G3SG62 H2QDF0 Q96AG4
ENSP00000225972 NP_060979.2.87134 NP_060979.2.92137 XP_003817501.1.60992 XP_004041379.1.27298 XP_511877.2.37143 ENSGGOP00000027098 ENSGGOP00000006171 9598.ENSPTRP00000015962 9606.ENSP00000225972 gi|40254924|ref|NP_060979.2| ENSPTRP00000015962 ENSP00000225972 ENSP00000225972 ENSPTRP00000015962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]