SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016020 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016020
Domain Number 1 Region: 450-628
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-50
Family SPRY domain 0.00083
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-19
Family RING finger domain, C3HC4 0.0097
Further Details:      
 
Domain Number 3 Region: 147-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000366
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016020   Gene: ENSPTRG00000009432   Transcript: ENSPTRT00000017303
Sequence length 630
Comment pep:known chromosome:CHIMP2.1.4:17:55564242:55590335:-1 gene:ENSPTRG00000009432 transcript:ENSPTRT00000017303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGAPYLCPQCRAVYQAR
PQLHKNTVLCNVVEQFLQADLAREPPADGWTPPARASAPSPDAQVACDHCLKEAAVKTCL
VCMASFCQEHLQPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICL
VEHKACSPASLSQASADLEATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQ
LQQEYTEMKALLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT
KRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIGQSTIDLKNELKQCIGRLQEPTP
SSGDPGEHDPASTHKSTRPVKKVSKEEKKSKKPSPVPALPSKLPTFGAPEQLVDLKQAAL
EAAAKATSSHPNSTSLKAKVLETFLAKSRPELLEYHIKVILDYNTAHNKVALSECYTVAS
VAEMPQNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPES
RLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLM
YKFRVDFTEALYPAFWVFSAGATLSICSPK
Download sequence
Identical sequences H2QDH5
ENSPTRP00000016020 XP_003817454.1.60992 XP_511899.3.37143 9598.ENSPTRP00000016020 ENSPTRP00000016020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]