SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016205 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016205
Domain Number 1 Region: 67-355
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.94e-124
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000000218
Further Details:      
 
Domain Number 2 Region: 369-481
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 4.58e-27
Family Anticodon-binding domain of Class II aaRS 0.000000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016205   Gene: ENSPTRG00000009541   Transcript: ENSPTRT00000017496
Sequence length 485
Comment pep:known chromosome:CHIMP2.1.4:17:63251225:63271165:-1 gene:ENSPTRG00000009541 transcript:ENSPTRT00000017496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRVAVRACHKVCRCLLSGFGGRVDAGPPELLTERSSPKGGHVKSHAELEGNGEHPEAP
GSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVV
FREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGK
LRENLLHGALEHYVNCLDVVNKRLPYGLAQIGVCFHPVFDTKQIPNGVKSIGEKTEASLV
WFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELI
ETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENS
FTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLET
MQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYIS
SAKNV
Download sequence
Identical sequences H2QDP3
ENSPTRP00000016205 ENSPTRP00000016205 9598.ENSPTRP00000016205 XP_001162210.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]