SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016233 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016233
Domain Number 1 Region: 264-345
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.19e-20
Family Complement control module/SCR domain 0.00000333
Further Details:      
 
Domain Number 2 Region: 83-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.2e-17
Family Complement control module/SCR domain 0.0000227
Further Details:      
 
Domain Number 3 Region: 205-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000594
Family Complement control module/SCR domain 0.0000167
Further Details:      
 
Domain Number 4 Region: 140-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.000028
Further Details:      
 
Domain Number 5 Region: 22-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000877
Family Complement control module/SCR domain 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016233   Gene: ENSPTRG00000009556   Transcript: ENSPTRT00000017524
Sequence length 345
Comment pep:known chromosome:CHIMP2.1.4:17:64862342:64880646:-1 gene:ENSPTRG00000009556 transcript:ENSPTRT00000017524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGG
MRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD
SAKCTEEGKWSPELPVCAPITCPPPSIPTFATLHVYKPSAGNNSLYRDTAVFECLPQHAM
FGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSL
DGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFC
KNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Download sequence
Identical sequences A0A2J8IXI4 Q95LB0
NP_001009118.1.37143 9598.ENSPTRP00000016233 ENSPTRP00000016233 ENSPTRP00000016233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]