SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016328 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016328
Domain Number 1 Region: 55-160
Classification Level Classification E-value
Superfamily Immunoglobulin 6.36e-22
Family V set domains (antibody variable domain-like) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016328   Gene: ENSPTRG00000009610   Transcript: ENSPTRT00000017624
Sequence length 238
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:73425009:73435294:-1 gene:ENSPTRG00000009610 transcript:ENSPTRT00000017624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHRRCKPELRQNFQSASGICICHWLQIRRTRSREGRAMWLPPALLLLSLSGCFSIQGPES
VRAPEQGSLTVQCHYKQGWETYIKWWCRGARWDTCKILIETRGSEQGEKSDRVSIKDNQK
DRTFTVTMEGLRRDDADVYWCGIERRGPDLGTRVKVIVDPEGAASTTASSPTNSNMAVFI
GSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSKLLTKDMAT
Download sequence
Identical sequences ENSPTRP00000016328 ENSPTRP00000016328 9598.ENSPTRP00000016328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]