SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016449 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016449
Domain Number 1 Region: 10-49
Classification Level Classification E-value
Superfamily UBA-like 0.000000383
Family TAP-C domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016449   Gene: ENSPTRG00000009676   Transcript: ENSPTRT00000017755
Sequence length 164
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:75228573:75235209:1 gene:ENSPTRG00000009676 transcript:ENSPTRT00000017755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQ
MMCTPSNTPATPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSH
QAPWIPPSSPTTFHHLHRPQPTWPPGAQQGGAQQKAMAAMDGQR
Download sequence
Identical sequences A0A2J8Y171 H2QDX7 Q8IYN6
ENSPTRP00000016449 9598.ENSPTRP00000016449 9606.ENSP00000331298 ENSP00000331298 NP_872371.1.87134 NP_872371.1.92137 XP_001151089.1.37143 ENSPTRP00000016449 ENSP00000331298 gi|32698954|ref|NP_872371.1| ENSP00000331298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]