SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016462 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016462
Domain Number 1 Region: 19-169
Classification Level Classification E-value
Superfamily Globin-like 1.99e-40
Family Globins 0.000000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016462   Gene: ENSPTRG00000033861   Transcript: ENSPTRT00000017768
Sequence length 189
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:75501967:75511386:-1 gene:ENSPTRG00000033861 transcript:ENSPTRT00000017768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PVYFKILSGVILEVAEEFASDFPHETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTP
PATLPSSGP
Download sequence
Identical sequences ENSPTRP00000016462 ENSPTRP00000016462 9598.ENSPTRP00000016462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]