SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016532 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016532
Domain Number 1 Region: 21-128
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000001
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000016532
Domain Number - Region: 134-245
Classification Level Classification E-value
Superfamily POZ domain 0.000102
Family BTB/POZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016532   Gene: ENSPTRG00000009722   Transcript: ENSPTRT00000017844
Sequence length 585
Comment pep:known chromosome:CHIMP2.1.4:17:77949966:77958643:-1 gene:ENSPTRG00000009722 transcript:ENSPTRT00000017844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASV
VCRALGFENATQALGRAAFGQGSGPIMLDEVQCMGTEASLADCKSLGWLKSNCRHERDAG
VVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANL
EAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLASAYGARQLQ
GYCASLFAILLPRDPSFQTPLDLYAYAVATGDALLEKLCLQFLAWNFEALTQAEAWPSVP
TDLLQLLLPRSDLAVPSELALLKAVDTWSWGERASHEEVEDLVEKIRFPMMLPEELFELQ
FNLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTSPTWSASVTD
SSWSARKSQLVYQSRRGPLVKYSSNYFQAPSDYRYYPYQSFQTPQHPSFLFQDKRVSWSL
VYLPTIQSCWNYGFSCSSDELPVLGLTKSGGSDRTIAYENKALMLCEGLFVADVTDFEGW
KAAIPSALDINSSKSTSSFPCPAGHFNGFRTVIRPFYLTNSSGVD
Download sequence
Identical sequences H2QE00
ENSPTRP00000016532 XP_511716.1.37143 9598.ENSPTRP00000016532 ENSPTRP00000016532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]