SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016572 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016572
Domain Number 1 Region: 335-438
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000051
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016572   Gene: ENSPTRG00000009740   Transcript: ENSPTRT00000017888
Sequence length 463
Comment pep:known chromosome:CHIMP2.1.4:17:79665326:79696591:1 gene:ENSPTRG00000009740 transcript:ENSPTRT00000017888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIPRPFFLQVYHTFLRIAETSVGDAV
LGLVCMLLLLVLKLMRDHVPPVHPEMPPGVRLSRGLVWAATTARNALVVSFAALVAYSFE
VTGYQPFILTGETAEGLPPVQIPPFSVTTANGTISFTEMVQDMGAGLAVVPLMGLLESIA
VAKAFASQNNYRIDANQELLAIGLTNMLGSLVSSYPVTGSFGRTAVNAQSGVCTPAGGLV
TGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFDTKIFRTLWRVKRLDLLPLCVTFL
LCFWEVQYGILAGALVSLLMLLHSAARPETKVSEGPVLVLQPASGLSFPAAEALREEILS
QALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQKQGVALAFVGLQVPVLRVLLSAD
LKGFQYFSTLEEAEKHLRQEPGTQPYNIREDSILDQKVALLKA
Download sequence
Identical sequences ENSPTRP00000016572 ENSPTRP00000016572 9598.ENSPTRP00000016572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]