SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016588 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016588
Domain Number 1 Region: 229-422
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-43
Family Pentraxin (pentaxin) 0.00061
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000016588
Domain Number - Region: 124-186
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0902
Family Apolipoprotein 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016588   Gene: ENSPTRG00000009746   Transcript: ENSPTRT00000017905
Sequence length 432
Comment pep:known chromosome:CHIMP2.1.4:17:79924038:79930616:-1 gene:ENSPTRG00000009746 transcript:ENSPTRT00000017905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGRAARTCALLALCLLGAGAQDFGPTRFICTSVPVDADMCAASVAAGGAEELRSSVLQ
LRETVLQQKETILSQKETIRELTAKLGRCESQSTLDPGAGEARAGGGRKQPGSGKNTMGD
LSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSR
VNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMY
AKVKKSLPEMYAFTVCMWLKSSAAPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKV
AKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENLAPYHPIKPQGVLVLGQEQD
TLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYGGA
TKWTFEACRQIN
Download sequence
Identical sequences G1S0T0 H2QE15
ENSNLEP00000019112 9598.ENSPTRP00000016588 XP_003280991.1.23891 XP_016788586.1.37143 ENSPTRP00000016588 ENSNLEP00000019112 ENSPTRP00000016588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]