SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016668 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016668
Domain Number 1 Region: 43-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000861
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016668   Gene: ENSPTRG00000009799   Transcript: ENSPTRT00000017991
Sequence length 203
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:81809689:81814823:-1 gene:ENSPTRG00000009799 transcript:ENSPTRT00000017991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTCPLAFPGPVSQALGALLFLATSLSAQNEGWDSPICTEGVVSVSQGENTVMSCNISNA
FSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLV
GHQRNNRQVTLEVSKKFFLLEPQMKVTALRAGAQQGLSRASAELWIPDSEPTPRPLALVF
KPSPLGALELLSPQPLFPDAADP
Download sequence
Identical sequences ENSPTRP00000016668 ENSPTRP00000016668 9598.ENSPTRP00000016668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]