SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016769 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016769
Domain Number 1 Region: 2892-3071
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-36
Family Laminin G-like module 0.00000476
Further Details:      
 
Domain Number 2 Region: 2298-2484
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-34
Family Laminin G-like module 0.00094
Further Details:      
 
Domain Number 3 Region: 2718-2883
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-32
Family Laminin G-like module 0.0000458
Further Details:      
 
Domain Number 4 Region: 2129-2297
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.81e-30
Family Laminin G-like module 0.00089
Further Details:      
 
Domain Number 5 Region: 2481-2676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.71e-26
Family Laminin G-like module 0.0095
Further Details:      
 
Domain Number 6 Region: 799-851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000151
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 849-903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000188
Family Laminin-type module 0.0013
Further Details:      
 
Domain Number 8 Region: 742-793
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000809
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 9 Region: 1044-1092
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 10 Region: 270-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000222
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 11 Region: 1461-1511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000418
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 12 Region: 1403-1454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 13 Region: 909-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 14 Region: 397-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 15 Region: 454-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 16 Region: 1509-1556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 17 Region: 995-1042
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 18 Region: 951-1000
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000239
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 19 Region: 327-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 20 Region: 703-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family EGF-type module 0.059
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000016769
Domain Number - Region: 78-156
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00034
Family APC10-like 0.059
Further Details:      
 
Domain Number - Region: 1361-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00226
Family Laminin-type module 0.055
Further Details:      
 
Domain Number - Region: 1090-1147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family Laminin-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016769   Gene: ENSPTRG00000009849   Transcript: ENSPTRT00000018099
Sequence length 3075
Comment pep:known chromosome:CHIMP2.1.4:18:9481123:9659630:1 gene:ENSPTRG00000009849 transcript:ENSPTRT00000018099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGGVLLVLLLCVAAQCRQKGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEHVPGRP
VRNPQCRICDGNSANPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVA
YVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRADDEV
ICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMT
LSHREPKELDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGES
CNRCCPGYHQQPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFRGGGV
CINCLQNTVGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLHN
GKRPGQCPCKEGYTGEKCDRCQLGYKDYPTCVSCGCNPVGSASDEPCTGPCVCKENVEGK
ACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIP
SQQDALGGRHQVSINNTAVMQRLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETV
DSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLM
TVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDLVVAADVEHCECPQGYTGTSC
ESCLSGYYRVDGILFGGICQPCECHGHAAECNVHGVCIACAHNTTGDHCEQCLPGFYGEP
SRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDRCAPGYSGAWCERCADGYYGNPT
VPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCR
ACECHVKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSMS
DGCTDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDCPHTQNTCDPETGECVCPPHT
QGVKCEECEDGHWGYDAEVGCQACNCSLVGSTHHRCDVVTGHCQCKSKFGGWACDQCSLG
YRDFPDCVPCDCDLRGTSGDACNLEQGLCSCVEETGACPCKENVFGPQCNECREGTFALR
ADNPLGCSPCFCSGLSHLCSELEGYVRTPVTLGSDQPLLHVVSQSNLRGTTEGVYYQAPD
FLLDAATVRQHIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGIGTSNFEPQVLI
KGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSDIEYI
LIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGY
HRGKLPAGSDRGPRPLVAPCVPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYG
KVTGSASDCALCACPHSPPASFSPTCVLEGDHDFRCDSCLLGYEGKHCERCSSGYYGNPQ
TPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVSCDDEC
VGVLLNDLDEIGDAILSLNLTGIIPAPYGILSNLENTTKYLQESLLKENMQKDLGKIKLE
GVAEETDNLQKKLTRMLASTQKVNRATERIFKESQDLAIAIERLQMSITEIMEKTTLNQT
LDEDFLLPNSTLQNMQQNGTSLLEIMQIRDFTQLHQNATLELKAAEDLLSQIQENYQKPL
EELEVSKEAASHVLSKHNNELKAAEALVREAEAKMQESNHLLLMVNANLREFSDKKLHVQ
EEQNLTSELIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLVMHMS
QRNAVDLVYRAEDHAAEFQRLADVLYSGLENIRNVSLNATSAAYVHYNIQSLIEESEELA
RDAHRTVTETSLLSESLVSNGKAAVQRSSRFLKEGNNLSRKLPGIALELSELRNKTNRFQ
ENAVEITRQTNESLLILRAIPEGIRDKGAKTKELATSASQSAVSTLRDVAGLSQELLNTS
ASLSRVNTTLRETHQLLQDSTMATLLAGRKVKDVETQANLLFDRLKPLKMLEENLSRNLS
EIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDNLLFYLGS
STASDFLAVEMRRGKVAFLWDLGSGSTRLEFPDFPIDDNRWHSIHVTRFGNIGSLSVKEM
SSNQKSPTKTSKSPGTANVLDVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCLGEAFLNGK
SIGLWNYIEREGKCRGCFGSSQNEDPSFHFDGSGYSVVEKSLPATVTQIIMLFNTFSPNG
LLLYLGSYGTKDFLSIELFRGRVKVMTDLGSGPITLLTDRRYNNGTWYKIAFQRNRKQGV
LAVIDAYNTSNKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVTTKSFVGCIKN
LEISRSTFDLLRNSYGVRKGCLLEPIRSVSFLKGGYIELPPKSLSPESEWLVTFATTNSS
GIILAALGGEVEKRGDREEAHVPFFSIMLIGGNIEVHVNPGDGTGLRKALLHAPTGTCGD
GQAHSISLVRNRRMITVQLDENNPVEMKLGALVESRTINVSNLYVGGIPEGEGTSLLTMR
RSFHGCIKNLIFNLELLDFNSAVGHEQVDLDTCWLSERPKLAPDAEDSKLLPEPRAFPEQ
CVVDAALEYVPGAHQFGLTQNSHFILPFNQSAVRKKLSVELSIRTFASSGLIYYMAHQNQ
ADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDGKWHMVKTDYVKRKGFITVDGRESPM
VTVVGDGTMLDVEGLFYLGGLPSQYQARKIGNITHSIPACIGDVTVNSKQLDKDSPVSAF
TVNRCYAVAQEGTYFDGSGYAALVKEGYKVQSDVNITLEFRTSSQNGVLLGISTAKVDAI
GLELVDGKVLFHVNNGAGRITAAYEPKTATALCDGKWHTLQANKSKHRITLIVDGNAVGA
ESPHTQSTSVDTNNPIYVGGYPAGVKQKCLRSQISFRGCLRKLALIKSPQVQSFDFSRAF
ELHGVFLHSCPGTES
Download sequence
Identical sequences K7B571
ENSPTRP00000016769 9598.ENSPTRP00000016769 ENSPTRP00000016769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]