SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016876 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016876
Domain Number 1 Region: 3157-3332
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-31
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 2987-3150
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.01e-28
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 2589-2760
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.05e-20
Family Laminin G-like module 0.0038
Further Details:      
 
Domain Number 4 Region: 2759-2928
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.24e-19
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 5 Region: 2387-2578
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000792
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 6 Region: 1356-1407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 1739-1789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000255
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 8 Region: 536-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 9 Region: 1687-1729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 10 Region: 1266-1314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 11 Region: 356-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 12 Region: 299-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.065
Further Details:      
 
Domain Number 13 Region: 491-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 14 Region: 631-681
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 15 Region: 1405-1453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 16 Region: 426-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 17 Region: 684-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000921
Family Laminin-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000016876
Domain Number - Region: 586-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000131
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 104-184
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00189
Family APC10-like 0.06
Further Details:      
 
Domain Number - Region: 1652-1689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Laminin-type module 0.051
Further Details:      
 
Domain Number - Region: 1318-1353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family Laminin-type module 0.027
Further Details:      
 
Domain Number - Region: 2100-2319
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0175
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 
Domain Number - Region: 1859-1994
Classification Level Classification E-value
Superfamily Tropomyosin 0.0399
Family Tropomyosin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016876   Gene: ENSPTRG00000009922   Transcript: ENSPTRT00000018220
Sequence length 3333
Comment pep:known chromosome:CHIMP2.1.4:18:19384193:19652721:1 gene:ENSPTRG00000009922 transcript:ENSPTRT00000018220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARPRGRALGPVLPPTPLLLLVLRVLPACGATARDPGAAAGLSLHPTYFNLAEAARI
WATATCGERGPGEGRPQPELYCKLVGGPTAPGSGHTIQGQFCDYCNSEDPRKAHPVTNAI
DGSERWWQSPPLSSGTQYNRVNLTLDLGQLFHVAYILIKFANSPRPDLWVLERSVDFGST
YSPWQYFAHSKVDCLKEFGREANMAVTRDDDVLCVTEYSRIVPLENGEVVVSLINGRPGA
KNFTFSHTLREFTKATNIRLHFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIGGQCV
CNGHAEVCNVNNPEKLFRCECQHHTCGETCDRCCTGYNQRRWRPAAWEQSHECEACNCHG
HASDCYYDPDVERQQASLNTQGIYAGGGVCINCQHNTAGVNCEQCAKGYYRPYGVPVDAP
DGCIPCSCDPEHADGCEQGSGRCHCKPNFHGDNCEKCAIGYYNFPFCLRIPIFPVSTPSS
EDPVAGDIKGCDCNLEGVLPEICDAHGRCLCRPGVEGPRCDTCRSGFYSFPICQACWCSA
LGSYQMPCSSVTGQCECRPGVTGQRCDRCLSGAYDFPHCQGSSSACDPAGTINSNLGYCQ
CKLHVEGPTCSRCKLLYWNLDKENPSGCSECKCHKAGTVSGTGECRQGDGDCHCKSHVGG
DSCDTCEDGYFALEKSNYFGCQGCQCDIGGALSSMCSGPSGVCQCREHVVGKVCQRPENN
YYFPDLHHMKYEIEDGSTPNGRDLRFGFDPLAFPEFSWRGYAQMTSVQNDVRITLNVGKS
SGSLFRVILRYVNPGTEAVSGHITIYPSWGAAQSKEIIFLPSKEPAFVTVPGNGFADPFS
ITPGIWVACIKAEGVLLDYLVLLPRDYYEASVLQLPVTEPCAYAGPPQENCLLYQHLPVT
RFPCTLACEARHFLLDGEPRPVAVRQPTPAHPVMVDLSGREVELHLWLRVPQVGHYVVVV
EYSTEAAQLFVVDVNVKSSGSVLAGQVNIYSCNYSVLCRSAVIDHMSRIAMYELLADADI
QLKGHMARFLLHQVCIIPIEEFSAEYVRPQVHCIASYGRFVNQSATCVSLAHETPPTALI
LDVLSGRPFPHLPQQSSPSVDVLPGVTLKAPQNQVTLRGRVPHLGRYVFVIHFYQAAHPT
FPAQVSVDGGWPRAGSFHASFCPHVLGCQDQVIAEGQIEFDISEPEVAATVKVPEGKSLV
LVRVLVVPAENYDYQILHKKSMDKSLEFITNCGKNSFYLDPQTASRFCKNSARSLVAFYH
KGALPCECHPTGATGPHCSPEGGQCPCQPNVIGRQCTRCATGHYGFPRCKPCSCGWRPCE
EMTGQCRCPPRTVRPQCEVCETHSFSFHPMAGCEGCNCSRRGTIEAAMPECDRDSGQCRC
KPRITGRQCDRCASGFYRFPECVPCNCNRDGTEPGVCDPGTGACLCKENVEGTECNVCQE
GSFHLDPANLKGCTSCFCFGVNNQCHSSHKRRTKFVDMLGWHLETADRVDIPVSFNPGSN
SMVADLQELPTTVRSASWVAPISYLGDKVSSYGGYLTYQAKSFGLPGDMVLLEKKPDVQL
TGQHMSIIYEETNTPRPDRLHHGRVHVVEGNFRHASSRAPVSREELMTVLSRLADVRIQG
LYFTETQRLTLSEVGLEEASDTGSGRIALAVEICACPPAYAGDSCQGCSPGYYRDHKGLY
TGRCVPCNCNGHSNRCQDGSGICVNCQHNTAGEHCEHCQEGYYGNAVHGSCRACPCPHTN
SFATGCVVNGGDVRCSCKAGYTGTQCERCAPGYFGNPQKFGGSCQPCSCNSNGQLGSCHP
LTGDCINQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVKSQLQGLSASAGLLEQM
RHMETQAKDLRNQLLNYRSAISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLN
NNVNRATQSAEELDVKIKNVIRNVHILLKQISGTDGEGNNVPSGDFSREWAEAQRMMREL
RNRNFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSIQDSLNEYEAKLSDLRA
RLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQL
MEKSQKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKHAQSLQELAKQLEEIK
RNASGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQTVIKEDLPRKAKTLS
SNSDKLLNEAKMTQKKLKQEVSPALNNLQQTLNIVTVQKEVIDTNLTTLRDGLRGIQRGD
IDAMISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTYGRTQNEDFKKALTDADNSVN
KLTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAASKVAVPMRFNGKSGVE
VRLPNDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDASRDYIGMAVVDGQLTC
VYNLGDREAELQVDQILTKSETKEAVMDRVKFQRIYQFARLNYTKGATSSKPETPGVYDM
DGRNSNTLLNLDPENVVFYVGGYPPDFKLPSRLNFPPYKGCIELDDLNENVLSLYNFKKT
FNLNTTEVEPCRRRKEESDKNYFEGTGYARVPTQPHAPIPTFGQTIQTTVDRGLLFFAEN
GDRFISLNIEDGKLMVRYKLNSELPKERGVGDAINNGRDHSIQIKIGKLQKRMWINVDVQ
NTIIDGEVFDFSTYYLGGIPVAIRERFNISTPAFRGCMKNLKKTSGVVRLNDTVGVTKKC
SEDWKLVRSASFSRGGQLSFTDLGLPPTDHLQASFGFQTFQPSGILLDHQTWTRNLQVTL
EDGYIELSTSDSSSPIFKSPQTYMDGLLHYVSVISDNSGLRLLIDDQPLRNNKRLKHISS
SRQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLTSNSLKRDVSLGGCSLNKPPFLMLLKG
STRFNKTKTFRINQLLQDTPVASPRSVKVWQDACSPLPKTQANHGALQFGDIPTSHLLFK
LPQELLKPRSQFAVDMQTTSSRGLVFHTGTKNSFMALYLSKGRLVFALGTDGKKLRIKSK
EKCNDGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTISIRAPVYLGSPPSGKPKSLP
TNSFVGCLKNFQLDSKPLYTPSSSFGVSSCLGGPLEKGIYFSEEGGHVVLAHSVLLGPEF
KLVFSIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMDSGAGGTSTSVTPKQSLCDGQ
WHSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAPANLTTPRIPVWKSFF
GCLKNIHVNHIPVPVTEALEVQGPVSLNGCPDQ
Download sequence
Identical sequences H2QEC7
XP_001156417.2.37143 ENSPTRP00000016876 ENSPTRP00000016876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]