SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016926 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016926
Domain Number 1 Region: 67-256
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.34e-52
Family Astacin 0.00013
Further Details:      
 
Domain Number 2 Region: 426-592
Classification Level Classification E-value
Superfamily TRAF domain-like 2.62e-34
Family MATH domain 0.0014
Further Details:      
 
Domain Number 3 Region: 264-427
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-29
Family MAM domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000016926
Domain Number - Region: 606-646
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00032
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016926   Gene: ENSPTRG00000009957   Transcript: ENSPTRT00000018275
Sequence length 701
Comment pep:known_by_projection chromosome:CHIMP2.1.4:18:27925283:27955724:1 gene:ENSPTRG00000009957 transcript:ENSPTRT00000018275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLWNLSWFLFLDALLVISGLPTPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQI
RNSIIGEKYRWPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGETNYISVFK
GSGCWSSVGNRRVGKQELSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRI
LSGREHNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFEDVIGQRMD
FSDSDLLKLNQLYNCSSSLSFMDSCSFELENVCGMIQSSGDNADWQRVSQVPRGPESDHS
NMGQCQGSGFFMHFDSSSVNVGATAVLESRTLYPKRGFQCLQFYLYNSGSESDQLNIYIR
EYSADNVDGNLTLVEEIKEIPTGSWQLYHVTFKVTKKFRVVFEGRKGSGASLGGLSIDDI
NLSETRCPHHIWHIRNFKQFIGSPNGTLYSPPFYSSKGYAFQIYLNLAHVTNAGIYFHLI
SGANDDQLQWPCPWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTDNGNYFWDRPSKVG
TVALFPNGTQFRRGGGYGTSAFITHERLKSRDFIKGDDVYILLTVEDISHLNSTQIQLTP
TPSVQDLCSKTTCKNDGVCTVRDGKAECRCQSGEDWWYMGERCEKRGSTRDTIVIAVSST
VAVFALMLIITLVSVYCTRKKYRERMSSNQPNLTPQNQHAF
Download sequence
Identical sequences A0A2I3SW10
ENSPTRP00000016926 XP_523904.2.37143 ENSPTRP00000016926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]