SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017093 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017093
Domain Number 1 Region: 42-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.1e-74
Family Lectin leg-like 0.00000000416
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000017093
Domain Number - Region: 279-318
Classification Level Classification E-value
Superfamily HMG-box 0.00176
Family HMG-box 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017093   Gene: ENSPTRG00000010060   Transcript: ENSPTRT00000018453
Sequence length 510
Comment pep:known chromosome:CHIMP2.1.4:18:55438201:55469484:-1 gene:ENSPTRG00000010060 transcript:ENSPTRT00000018453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSRQRGLRARVRPLFCALLLSLSRFVRGDGVGGDPAAALPHRRFEYKYSFKGPHLVQS
DGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGA
DGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQN
DGASQALASCQRDFRNKPYPVRAKITYYQKTLTVMINNGFTPDKNDYEFCAKVENMIIPA
QGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQEL
DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQR
RYVSSLTEEISKRGAGVPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGM
QHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVH
FIIFVVVQTVLFIGYIMYRSQQEAAAKKFF
Download sequence
Identical sequences H2QEL7
ENSPTRP00000017093 ENSPTRP00000017093 XP_001143039.1.37143 9598.ENSPTRP00000017093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]