SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017177 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017177
Domain Number 1 Region: 72-160
Classification Level Classification E-value
Superfamily F-box domain 9.81e-18
Family F-box domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017177   Gene: ENSPTRG00000010109   Transcript: ENSPTRT00000018544
Sequence length 421
Comment pep:known_by_projection chromosome:CHIMP2.1.4:18:70372318:70437985:-1 gene:ENSPTRG00000010109 transcript:ENSPTRT00000018544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGRGRILRQHWLGLQTLRGPSRGGGAARGRARAFGCRKGPGVKLSAGSAALRCHARGG
QHWESSFSCCSGFLDGMPSEILLKIFSYLDAVSLLCTGCVSRRFYHLANDNFIWIGIYST
AFSPARSNWKFNSVEKIAMSMSFLSVQDKEAGYWKKEYITKQIASVKAALADILKPVNPY
TGLPVKTKEALRIFGLGWAIILKEKSGKEYIMEHVDLSINDTSVTVIWYGKKWPCLASLS
TLDLCGMTPVFTDWYKTPTKHRLRWHSLIAKYNLSHLTVSTMIGCDRLIRIFCLHPGLLV
GVWKKEEELAFVMANLHFHHLVERSTLGSATIPYELPPHSPFLDDSPEYGLHGYQLHVDL
HSGGVFYLCGTFRNLFTKRGNIENGHVKLIVIHLKNNREHLPLIGKVGLSWKTDIFDGCI
K
Download sequence
Identical sequences ENSPTRP00000017177 ENSPTRP00000017177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]