SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017238 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017238
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily PH domain-like 6e-46
Family Phosphotyrosine-binding domain (PTB) 0.00000121
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000017238
Domain Number - Region: 316-351
Classification Level Classification E-value
Superfamily SH2 domain 0.000996
Family SH2 domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017238   Gene: ENSPTRG00000010145   Transcript: ENSPTRT00000018609
Sequence length 353
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:363018:378342:-1 gene:ENSPTRG00000010145 transcript:ENSPTRT00000018609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAPNKALASVLGKSNLR
FAGMSISIHISTDGLSLSVPATRQVIANHHMPSISFASGGDTDMTDYVAYVAKDPINQRA
CHILECCEGLAQSIISTVGQAFELRFKQYLHSPPKVTLPPERLAGPEESAWGDEEDSLEH
NYYNSIPGKEPPLGGLVDSRLALTQPCALTALDQGPSPSLRDACSLPWDVGSTGTAPPGD
GYVQADARGPPGHEEHLYVNTQGLDAPEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTA
APTVEDQWPSPPTRRSDGDFHVRESVTNPRLYVLTGMHAGQPKRLLVLDTEGV
Download sequence
Identical sequences ENSPTRP00000017238 ENSPTRP00000017238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]