SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017511 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017511
Domain Number 1 Region: 216-335
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-28
Family SH2 domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017511   Gene: ENSPTRG00000010300   Transcript: ENSPTRT00000018922
Sequence length 340
Comment pep:known chromosome:CHIMP2.1.4:19:4301863:4313841:1 gene:ENSPTRG00000010300 transcript:ENSPTRT00000018922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKWLRDYLSFGGRRPPPQPPTPDYTESDILRAYRAQKNLDFEDPYEDAESRLEPDPAGP
GDSKNPGDAKYGSPKHRLIKVEAADMARAKALLGGPGEELEADTEYSDPFDAQPHPAPPD
DGYMEPYDAQWVMSELPGRGVQLYDTPYEEQDPETADGPPSGQKPRQSRMPQEDERPADE
YDQPWEWKKDHISRAFAVQFDSPEWERTPGSAKELRRPPPRSPQPAERVDPALPLEKQPW
FHGPLNRADAESLLSLCKEGSYLVRLSETSPQDCSLSLRSSQGFLHLKFARTRENQVVLG
QHSGPFPSVPELVLHYSSRPLPVQGAEHLALLYPVVTQTP
Download sequence
Identical sequences H2QF11
ENSPTRP00000017511 9598.ENSPTRP00000017511 ENSPTRP00000017511 XP_009432670.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]